GenomeNet

>ahp:V429_18585 K01961 acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14] | (GenBank) acetyl-CoA carboxylase (A)
MLDKVVIANRGEIALRILRACKELGIKTVAVHSTADRELKHVLLADETICIGKPASTDSY
LNVPAIIAAAEVTGAVAIHPGYGFLSENADFAEVVEKSGFIFIGPRAETIRLMGDKVSAI
EAMKKAGVPCVPGSDGPVDSDAKHNAAIAKRIGYPVIIKAAGGGGGRGMRVVRSEAELSA
AIALTKSEAGQFFKNDMVYMEKYLENPRHIEIQVLADGQGNALYLGERDCSMQRRHQKVV
EEAPAPGITEEMRKFIGERCVRACIEIGYRGAGTFEFLYENGEFYFIEMNTRIQVEHPVT
ELVTSVDLIKEQLRIAAGQPLSITQQDIRIRGHAIECRINAEDPATFMPSPGLIQRFHAP
GGLGVRWDSHIYAGYKVPPYYDSMIGKLICYGENRDVAIARMRQALDELVVEGIKTNVSL
QKEIMKDENFQHGGTNIHYLHKKLGL

BLAST