GenomeNet

>aju:106983760 K15363 fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1] | (RefSeq) FAN1; fanconi-associated nuclease 1 isoform X1 (A)
MMSEGKAPAKKRPRRSLSASKTKTKECNSIISFFNNAPPAKLACPVCSKMVQRYDLNRHL
DEKCANNDDITPVDQRHVDLTNSHVPTVDLTNIVLEDVMPGKLSPSKISLTPDQSDSANM
GIKQQTSPYFKNNDDLGCKNQDKLRHHNVKVITLGSLSSKLSRRYTEAKRAIDKNEEFAN
KSPQSSSSTVVRTLVDNCSETEDKDQILENSSQKENVFACDSLKERSTPEHTVEGTKIME
AESQTATQEYERSPLGPAFSDNAAMLFSPDLTLGNTLKSTSEHSLAKWESIKGVDNQDVE
KCEAGSCEEVKVTVASETKIQLSNWEAKSDSSTHDDSKGHNIQYLSPEGDSDLKNEITCG
IPLEQGSSCDVPGKTITVPPSHPYYLRSFLVVLRAVFENEEDRMLFDEHERGIVTKFYQL
SASGQKLYVRLFQRKFGWIKMNKLEYEEIAPDLTPVIGELQQAGFLQTESELQELSEVLE
LLSAPELKTLAKTFHLVNPNGQKQQLVDTFLKLAKQPSVCTWGKNQSGIGAVILKRAKDL
AGESLRVCKGPRAVFSRVLLLFSLTDSMEDEEAACGGQGQLSTVLLVNLGRMEFPRYTIN
RKTQIFQDRDDLIRYAAAAHMLSDISTAMANGNWKEAKELSQCAKSDWNKLKNHPSLRYH
ENLPLFLRCFTVGWIYTRILSRTVEILQRLHLYEEAVKELENLLSQKVYCPDSRGRWWDR
LALNLHQHLKRLEPAIKCIAEGLADPEVRTGHRLSLYQRAVRLRESPSCQKYRHLFHRLP
EITVEDVKHVTITGRLCPQRGMGKSVFVMEAGGPTAPATVLCSVEEVALAYYRRSGFDQG
IHGEGSTFSTLYGLLLWDVIFMDGIPDVFRNAYQACPLDLCTDSFFTSRGPAIEARLQLI
HSAPAESLRAWVSAAWQAQEGRVASIVSWDRFASLQQAQDLVSCLGGPVLSGVCRRLAVD
FRHCRGGLPDLVVWDSQSHRFKLVEVKGPNDRLSHKQMVWLHELQKLGAEVEVCHVVAVG
AKSKGLN

BLAST