GenomeNet

>alc:OTEC02_13385 no KO assigned | (GenBank) hypothetical protein (A)
MKKVVTLLCGICFIGLTHAETQYSPPPIQLEPLAKFSVDLNAPVWELGTTSDAGKRRIIP
ITGGTFEGKSLKGRILNNGADWQIVDSKGLAIIDTRYLLETDDGALIYLQTKGYRHGSAE
TLKQLAQGKDVDPKNYYFKITMQFETSSPKYSWLNQTVAVGSAMRLGKAVIYDAYTLK

BLAST