GenomeNet

>alf:CFBP5473_05075 K21929 uracil-DNA glycosylase [EC:3.2.2.27] | (GenBank) DUF4130 domain-containing protein (A)
MYSVELEGRGDFVEWRNAARSLLMADIDPRDVDWRLESERGTLLGFEESRSIPAGDSSRA
ISVPAAFLPLAEAVICHSDPARFALLYRLLWRLQKDRSLLQIKADPNVLTARHLEKSVRR
DSHKMTAFVRFKEVEGEGPAARRCFIAWFEPDHFIVERKAPFFQRRFTDMDWLIATPKGS
ARWDGKTLETSREAAEKPDLTDETDELWRTYYANIFNPARLKIKAMTAEMPKKYWKNLPE
AGLIPELILGAEARVLEMGAKAATEPQLFHHRLQAAASAKPEELLPDADTLAGLKREAQS
CELCPLHCKATQTVFGEGLSDAEIMIVGEQPGDHEDLAGRPFVGPAGRVFDQVLAETEID
RKSLYVTNAVKHFKYEARGKKRIHQRPDAGEVERCRWWLTREIELVQPKLIVAMGATAVY
SLTGMKEKISDLRGRPMPMSEGRMLFVTVHPSYLLRIPDESQKSYEFARFRDDMKLMKEI
AANL

BLAST