GenomeNet

>amj:102577198 K00029 malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40] | (RefSeq) ME1; malic enzyme 1 (A)
MERVRRPAGPRRPQLLAPQRGYALTRDPRLNKGMAFTLEERQQLNIHGLLPPCFLSQEVQ
VLRILTNFERQASDLDRYILLMGLQDRNEKLFYKVLTSDIEKFMPIVYTPTVGLACQLYG
LAFRRPRGLFITIHDRGHIATILKSWPENVIKAIVVTDGERILGLGDLGSYGMGIPVGKL
ALYTACGGMKPQECLPVMLDVGTDNEELLKDPLYIGLRHKRVRGQAYDDLLDEFMQAVTS
RYGMNCLIQFEDFANANAFRLLHKYRNIYCTFNDDIQGTAAVAVAGLLAALRITENKLSD
HTILFQGAGEAALGIANLIIMAMQKEGTAEDEAIKKIWMVDSKGLIVKERSSLTAEKKRF
AHKHDEMKNLEDVVKDIKPSVLIGVAAIGGAFTKEILKDMASFNKRPIIFALSNPTSKAE
CSAEQCYQVTQGRGIFASGSPFDPVTLPDGCTLYPGQGNNAYVFPGVALGIVSCGVRHIT
DEIFLTTAEVIAQQVSEKHLQEGRLYPPLMTIQDVSLKIAVKIAEQAYSNNTASFYPEPK
DKEALIRSQVYSTDYEDFMAESYAWPEEAMKIQT

BLAST