GenomeNet

>amj:106737076 K04345 protein kinase A [EC:2.7.11.11] | (RefSeq) cAMP-dependent protein kinase catalytic subunit alpha (A)
MSALQRLESLAGRIFSWGPRGDPGDPESTGRVPETEHAAAWNQQMKEFLAKAKEDFLKKW
ESPSQNTASLDQFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLN
EKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYIPGGEMFSHLRRIGRFSEPHARFYAAQI
VLTFEYLHSLDLIYRDLKPENLLIDQQGYIEVTDFGFAKRVKGRTWTLCGTPEYLAPEII
LSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLR
NLLQVDLTKRFGNLKNGVADIKNHKWFGTTDWIAVYQRKVEAPFIPKCKGPGDTSNFDDY
EEEEIRVSLTEKCAKEFAEF

BLAST