GenomeNet

>amv:ACMV_23190 K02031 peptide/nickel transport system ATP-binding protein K02032 peptide/nickel transport system ATP-binding protein | (GenBank) ABC transporter ATP-binding protein (A)
MSAVLAGTERDGATAATPALAVEGLEVAYRTRGQELAVLRGVSFSIAPGESFGLVGESGC
GKSTAALAALGALPRNGRVRAGSIRIGGEDLARLDAGALRRLRARRVSMVYQDASRALNP
ALTIGVQLREAFELLGIAGAAAGARSREALDQVRIAAPGRVLAAYPHELSGGMLQRVVIA
MALAKDPALLVLDEPTTALDATVEAEVLDLIATLRAVHGTSVLFISHNLGVIEQMCDRIG
VLYAGSLVEQGGAARLLERPLHPYTIRLLRCLPAPGRNKVTSRLDTIPGFLPPPGAMVPG
CVFAPRCDLADQTCRTRPPPPHREGEQTTRCHHWQRAGTLADAPAAALAPPEAAPAETVL
RAENLSKTFAIGGRALRALGEVSLTLGRGETLGIVGESGSGKTTLARLLLGLVRPDAASR
VELAGELAAPEAAGRSDAQRKALQIVFQNPDSALNRAHSVRHLIGRALRRLAGLAPGQAE
ARLAELVAAVRLTERHLAMRPRQLSGGLKQRVAIARAFAGEPRVIICDEPTSALDVSVQA
AILNLLADLQRERQVSYIFISHDLGVVRYISDRIAVLYLGRIMELGPAEAVFSGPHHPYT
EALLSAVATPGGRSGRIRLAGEIPSPLNPPQGCAFHTRCPRKLGAVCETTEPALETIGDH
AIRCHIPRDALGRRGA

BLAST