GenomeNet

>aper:A0U91_01845 K16012 ATP-binding cassette, subfamily C, bacterial CydC | (GenBank) thiol reductant ABC exporter subunit CydC (A)
MNISDQKEASTPALTDCQAVLRILGLWRRQAPRLIIGVMLALIALCLGLVLMQASGLRLA
SSVLGEVVITTALLRWVGGGRVVLRYAERLFAHDAMFRALADLRVWFFHSLAQGAAAGLG
FRRAGDMLSRLVSDIGTLDGLYLRIFVPFACACLTLPILVVQLGRQSIVLGVAVGLLFAC
SAFGVPYLIARSGRAEGERLGKNLAALRIGVLDLVGGLREIRAFGAEGRILSHVQADDAA
LLAGQMRLARRAAYANASAFLCGQAAIFLVLLAAAGVFALHLSPLAVVGSLFLTVASFES
AATLTRAGLQAGVMGAAAQRVVEVAAHTPDSKQSKAQTEAPAGTDIRLDGVKFRWAPDRP
LVFDGLTLDIPAGARVAILGPSGVGKSSLAALLLKAATPEAGNITLGGEDISHIRADSLR
QRMAWLSQATHLFDDSIRANLLLGRPDATEDDLWKALEDAAVADVVKTLPDGLDTWLGEG
GIKLSGGQGRRIALARTLLTQAPILILDEPATGLDAQTEQEFLRTLNTVTEGRTVILIAH
RLTGVETLDRIWRLSGGVATAAAA

BLAST