GenomeNet

>app:CAP2UW1_4458 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) alkyl hydroperoxide reductase, F subunit (A)
MLDANIKTQLTAYLEKIRQPIELVASLDGSEKAGEMWALLQDIAALSDKVSIRNDGVAPR
KPSFAVARAGEPARIRFAGIPMGHEFTSLILALLQVGGHPPKAEASTIEEIRAIPGTFHF
ETFISLSCHNCPDVVQALNLMAVLNPGISHEMIDGALFQDEVTSRQIMGVPTVLLNGEHF
GQGRMLLEEIVGKIDTGALQREAEKISAREPFDVLIVGGGPAGAAAAIYAARKGIRTGVV
SERFGGQVLDTLGIENFISVSQTDGPKLAAGLEQHVREYDVDVMDLQRAEALLPGSDGGP
SEIRLASGAKLRSQTVILATGARWREMNVPGEKEYRGHGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGVVAHVTVLEFDSILRADAILQKKLFSLANVKVITSALTTEVTGDGK
KVNGLVYTDRSSGEAHRVELEGVFVQIGLLPNTEWLKGTIALSPRGEIEIDARGETSLPG
VFAAGDVTTVPYKQIVIAMGEGAKASLSAFDYLIRSSVT

BLAST