GenomeNet

>asz:ASN_3590 K16012 ATP-binding cassette, subfamily C, bacterial CydC | (GenBank) cydC; putative transport ATP-binding protein CydC (A)
MPDVTQNSSAPATSSAGQPNTPAVTDRQAIFRILKLWQRQAPRLAIGLMLALLALCTGLL
LMQVSGLRLAGAVLGEVIITTALLRWVGVGRVFLRYSERLFAHDAMFRALADLRVWFFHS
LARGAAAGLGFRRAGDMLSRLVSDIGTLDGLYLRILLPFMCACLTLPILLVQLCSQNIIL
GCLTGLLFACSAFLFPYLIARSGRQDAERLTQNLSALRISVLDLVSGLREIRAFGAENRM
LARVQADDRALLDGQKHLARRAAIANATAYLCGQIAILFVLLAISGIVFSKVAPLSGVGI
LFLTVAAFESAGALTRAGVQAGAMGAAARRVVEIAQVAPVSAQTEQEADAPAGTDIQVTN
VKFRWSSDRPYVFDGLTLDIPAGSRVAILGPSGVGKSSLAALLLKAAAPESGCITLGGVN
ISHIRATSLRRQVAWLSQATHLFDDTIRSNLLLGKPEATEEDLWRALEEAAVAGVVRNLP
EGLDTWLGEGGVNLSGGQGRRIALARTLLTNAPIMILDEPATGLDAQTEQDFLRTLNTVT
AGRTVILIAHRLTGVEKLDQIWRLSHGQATTVAVS

BLAST