GenomeNet

>ats:109764751 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] | (RefSeq) LOC109764751; DNA ligase 6 isoform X1 (A)
MASLLCSPASKSLSVTTSTLFLSSLASLTPAHTHPLSASAATPPVPASVPPTGLIPNSRF
LVDAFRHAGDFSVAYFLSHFHSDHYAGLGPSWRRGLVFCTAPTARLLASVLSVPPELIVS
IDIDVRITVDGWSVVAVDANHCPGAVQFLFTSPGPNPERYVHTGDFRYTHSMRSNPNLLE
FVGADALFLDTTYCNPKFTFPSQEESLEYVVNTIKQVKEESGAAGERVLCLIATYVVGKE
RILLEVARRCRCMIHVDSRKMEILTVLGFGGEKGVFTEDASATDVHVIGWNILGETWPYF
RPNFVKMKEIMVERGYTKAVGFVPTGWMYETKKEGFAVRVKDSLKIHLVPYSEHSSYDEL
RDYVKFLHPKRVIPTVGVDGGKLDGKEAIALQKHFVGLVDETANKHEFLMAFNRRSAHAS
LSHEDVLAKCCREQDGEEFALPENNSVSELPDNSEIKITEGMKKELSDFLPSWVNQDQIQ
GLLMSSGGDVVQSASAFFERERDFFEEANVSNNEKPKSVEIRTSDHGSSADTSSQQEVPS
FSQKPMEHSAKLVNLTPVRMNSNQTKKERKRGSSTVNKSKKKGKSTASTEAGGRKQPTIT
NYFGRAPAAASKSESANKVTVDPHQNNGENNNQSMDIVESHKQGVDQLLQIVDGSMSRES
AISLLEKTKGDVNVAVDMFYSKIQNNNVPDSDKSIVPQNTQNEMIDKYDNTNMVHNSSQA
TPKMQNLYVQTSVAQADSMNISLPVEKYLPIEHACWTAGHPAPYLHLARTFDLVEREKGK
IKTTAMLCNMFRSLLALSPDDVLPAVYLCTNKISPDHENMELNIGGSLVISAMEESLGTS
KSKIHEMYKTYGDLGDVAQECRQNQTLLAPPRPLSVRDVYSTLRKLSAISGGGSAGRRKI
LVLHLIRSCREMEMKFLVRTLVRNLRIGAMMKTILPALAHAVVLHEKCSTGPVVSLEGVK
SQLQSLSTEVTEAYNVIPNMDLLVPSLLCEGATFAASSLAMVPGTPIPPMLARITNGVTQ
ALKLFHGRAFTCEYKYDGQRAQIHRLTDGSVQIFSRQMKDSTSRFPDLVNMIKELCNSEV
ASFILDAEVVGIDRNKGNRLMSFQELSSRERGSKNSSIAIQNIKVDICVFVFDIMFCNGQ
RLLDNPLRQRRSYIHDLFQEKPGYLELAQQLTVEEDEASIDNSSTLHRMSSFFEKACQSS
CEGIMLKTLDIDAGYSASKRCDSWLKVKRDYVEGLGDSLDLVPIGAWYGNGRKAGWYSPF
LMACYNPESEEFQSVCRVMSGFSDDFYKEMKEFYSGEKILPKKPVYYKTDEQPELWFTAE
QVWEIRGADLTLSPVHHAAIGIVHPSRGISVRMPRHIRCVPDRSPEDCSTATDVASMFRA
QTRKMEVSSDGPGASHQ

BLAST