GenomeNet

>avn:Avin_50650 K02017 molybdate transport system ATP-binding protein [EC:7.3.2.5] | (GenBank) modC1; Mo transporter, inner membrane ATP-binding component, ModC1 (A)
MNTSFEPGTKGETGALSGGLPADGIRARFRVDYAGFALDVDLTLPGHGVTALFGHSGSGK
TTLLRCVAGLERAAEARLEINGELWQDSAAGVFLPTHRRALGYVFQEASLFPHLSVRRNL
EYGMKRVDAASRQVSWERVLELLGIGHLLERLPGRLSGGERQRVGIARALLTSPRLLLMD
EPLAALDLKRKNEILPYLERLHDELDIPMLFVSHLPDEVARLADHVVLLDQGRVTAQGSL
QDIMARLDLPTAFHEDAGVVIESVVAEHDDHYHLTRLAFPGGAVLVARRPEAPGQRLRLR
VHARDVSLANSRIEDSSITNVLPATVREVVEADTPAHVLVRLEAEGTPLIARITRRSCDQ
LGIAPGRRMWAQIKAVALLG

BLAST