GenomeNet

>azd:CDA09_08150 K02339 DNA polymerase III subunit chi [EC:2.7.7.7] | (GenBank) DNA polymerase III subunit chi (A)
MPPRVQFYHNAEHPLALACDLAARAFGSGRKVALRTADAASARQLDQLLWSFEQQAFVPH
VMAGSALAAETPVVVGHAEAPGEWPHTEILFNLADDVPPGFERFRMVVEIIGQSEAQKRP
ARARWMHYKQKDLPLQAFDAIRREAL

BLAST