GenomeNet

>babt:DK49_1783 K14980 two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3] | (GenBank) HAMP domain protein (A)
MVAETQKDSLSGMRERRARRQRSVFLRRFLSPLRKFLGQYLFSSLTRRILFLNLAALAVL
VSGILYMNQFREGLIDAKIESLLTQGKIIAAAISASVTVDTNSLLIDPEKLLELQAGQSI
TPSPDSPDNWEFPINPEKVSPLLRQLISPTSTRARIYDRYANKLLDSRALYSTSFPSSGP
VLRYDLPPIEDETPALWERIGSWLSRLFYGGGLPLYQEQPGGNGLAYQEIVKALSGSPQM
AQRRNQRGELIVSVAVPIQRSRAILGVLLLSTEGDDIDKIVQAERMAVFRVFGVVSAVMV
ILSLFLASTIANPLRKLSAAADRVRHGVKNRVEIPDFSERQDEVGHLSTSIRDMTDALYT
RIEAIESFAADVSHELKNPLTSLRSAVETLPLAKTDESRKRLLDVIQHDVRRLDRLITDI
SDASRLDAELAREHIDRVDMKKLLTSLVTAAREVRRNKVGTEIVFNTGKLPTGKKGFYVA
GHDLRLGQVVSNLIENARSFVPDDTGRIVVTLAGEGNRLRILVEDNGPGIPIENIERIFE
RFYTDRPASEAFGQNSGLGLSISRQIIEAHGGALTAENITDPDKPDIFKGARFIVDLPAS
A

BLAST