GenomeNet

>bacu:103011866 K00710 polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41] | (RefSeq) WBSCR17; Williams-Beuren syndrome chromosome region 17 (A)
MVFLPVAGSLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSEKISLD
RSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTPTHLLKEIILVD
DNSDEEELKAPLEDYVHKRYPGLVKVVRNRKREGLIRARIEGWKVATGQVTGFFDAHVEF
TAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELWCMYISPPKDWW
DAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIKVWLCGGSMEVL
PCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLPLENPGIDIGDV
SERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNSKAKDVCLDQGPLENHTAIL
YPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSRSRLPQLLDCDKVKGSLYKR
WNFIQNGAVMNKGTGRCLEVESRGLAGIDLILRSCTGQRWTIKNFIK

BLAST