GenomeNet

>bag:Bcoa_0517 no KO assigned | (GenBank) flagellar protein (A)
MAELANCPNCGKLYVKNSVRDVCEDCYREEEAAFERVFQFLRKRENRAATIETIVEKNNV
PEKLVFKWVRSGRLLIAHFPNLAYPCDRCGKLIQSGKLCEECAKTIAKDLERFEKEKKRQ
EEIRKKTYHIK

BLAST