GenomeNet

>bbub:102390030 K19523 carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21] | (RefSeq) CPT1B; carnitine O-palmitoyltransferase 1, muscle isoform isoform X1 (A)
MAEAHQAVAFQFTVTPEGVDFQLSREVLKHIYLSGIRSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATAGSSYYNVDISMGLVYYIQRWLPEGRPYRTPYTRTLFSMAIFSTGVWMMGI
FFFRQTLKLLLSYHGWMFEMHGQTSHLTRVWAVCVRLLSGRQPMLYSFQTSLPKLPVPSV
PATVHRYLESVEHLLDDEQYYRMETLAKEFEEKTAPRLQKYLVLKSWWATNYVSDWWEEY
VYLRGRNPIVVNSNYYVMDLVLVKNTDVQAARLGNAVHAMITYRRKLDREEIKPVMALGL
VPMCSYQMERMFNTTRIPGKDTDVLQHLPDSRHVAVYHKGRFFKVWLYEGSRLLKPRDLE
MQFQRILDDPSPPQPGEERLAALTAGGRVEWAQARQAFFSSGKNKAALDAIERAAFFVAL
DEESHHYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNTEHAWADAPII
GHLWEFVLGTDSFHLGYTETGHCLGKPNPVLPPPQRLQWDIPEQPSGLLDMTPESCWRAL
PPADPSVSWQCQAVIESSYQVAKALADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQ
LAHFRDRGKFCLTYEASMTRMFREGRTETVRSCTRESTAFVQAMVQGRHLNEDLQRLFRK
AAEKHQNMYRLAMTGAGIDRHLFCLYVVSKYLGVESPFLAEVLSEPWRLSTSQIAQFQIR
MFDPNKYPKHLGAGGGFGPVADDGYGVSYMIAGENTIFFHVSSKFSSSETNAQRFGNQIR
QALLDIANLFQVPKADG

BLAST