GenomeNet

>bbub:102393858 K17965 nuclear receptor-interacting protein 1 | (RefSeq) NRIP1; nuclear receptor-interacting protein 1 (A)
MTHGEELGSDVHQDSIVLTYLEGLLMHQAAEGSGTAVDKASAGRNEDDQNFNISGSAFPT
CQRNGPVLSTHTYQGSGMLHLKKARLLQSSEDWNAAKRKRLSDSIVNLNVKKEALLAGMA
DSAPKGKQDSKVLASLLQSFSSRLQTVALSQQIRQSLKEQGYALSHNSLKVEKDLRCYGV
ASSHLKTLLKKSKAKDQKPDTNVPDVTKTLIRDRFIESPHHVGQSGTKVMSEPLSCAARL
QAVASMVEKRASPATSPKPSVACSQLALLLSSEAHLQQYSREHALKTQNANQAASERLAA
MARLQENGQKDMGSFQLSKGISGHLNGQARTSSNKLMASKSTAFQNPVGIVPSSPKNAGY
KNSLERNNIKQAANNSLLLHLLKSQTIPKPMNGHSHSERGSIFEESSTPTTIDDYSDPNP
SFTDESSGDESSYSNCVPIDLSCKHRIEKPEPDQPVSLDNLTQSLLNTWDPKVPEVDVKE
DQDTSKNSKLNSHQKVTLLQLLLGHKNEENMERNGSPQEAHSDETKFSTQNYTRTSVIES
PSTNRTTPVSTPPLLASTKADSPINLSQHSLVIKWNSPPYACGPQPEKPASTASNHLMDL
TKSKESQGEKAIHNEGAQNSATFSASKLLQNLAQCGMQSSVSGEEQRPSKQLLSVNTDKP
PGMIDRLNSPLLANKTSAVEEKKVFGSHTVGPEPGLSGSEIENLLERRTVLQLLLGNPNK
GKTEKKEKMPLRDESTQEHTDRALSEQILMVKIKSEPCDDLRLHATGTHLSHEAPGVPFL
GMAPPMQRSAPALPASEDLKPEPGSPQDFSFSKNGLLSRLLRQNQDSHLADELDSSHRNS
ELTLVESKNLCMVPKKRKLYTEPLENPFKKMKNNTVDAANSHSAPEVLYGSLLNQQELKL
SRSDLEFKHPASHGSASESEPRNWTRESKSFNVLKQLLLSENCVRDLSQHRSNSVADSKK
KGHRNSMTNSKPEFSIASLNGLMCGATQPGGCMVSRTFPYPGIGKAPRSPPFPEHLGCAG
SRPEAGLVNGCSMPSEKGPIKWVITDVDKNEYEKDSPRLTKTNPILYYMLQKGGTSVTSR
ETQDRDIWREPSSAESISQVTIKEELLPAAETKASFFNLRSTYNSHMGNNASLPQSANGE
VYGLLGNMLTIKKESE

BLAST