GenomeNet

>bcac:CGC64_15230 K07058 membrane protein | (GenBank) YihY/virulence factor BrkB family protein (A)
MKILAQNKKKLSVSIKIIKDTFQGFIDDNVMRLSASLAYATLFSIIPLLSLLVTIGVLLN
IDFTNQLYAQLEPIVGSKVIDALQAIMENAETTDSFSFATIISIGVTIFGATTVFAEIQS
SLNTIWGIKAVPKKSWLKYIINRLLSFSVILAFAFILLITFTITNLITDISNKFITNNPD
IAESLVKTIGMIINIGVTTVIFTLIFKILPDAKIKSKDVIIGALVTTVLLLIGQWGISFY
IGFANIETVYGAAAFMAIFITWIYYSAIIIYTGAEFTKAWANELGGKIFPDEYAVATKVI
EIREENKPVN

BLAST