GenomeNet

>bcm:Bcenmc03_6354 no KO assigned | (GenBank) conserved hypothetical protein (A)
MKTKMNVKLTGIALSVAAVFSLAATASQAVVVTAVPGSLSNTDGLIIEGASPATGGLIGT
VTGWGNGVVTVGNPNAGGISIGLAGTGTGSAAIGIGSGLLEPVAGVAGTVTGALGGLGGS
GGTTGGLGGVVGTVANAATGAVGAVTGVLGGIGGSGGATGGLGGVVGTVTGALGGIGGGN
PTGGLGGVVGTVANTATGAVGTLTGALGGVGGGTGGLGGIVGTVGNAASGAVGTVTGALG
GVGGGGTGGLGGVVGTVTGALGGIGGGTGGLGGVVGTVANTATGAVGTLTGALGGVGGGA
GGLGGVVGAVGNAASGAVGTVTGALGGVGGGGTGGLGGVIGTVTGALGGIGGGTGGLGGV
VGTVANTATGAVGTLTGALGGVGGGTGGLGGVVGAVGNAASGAVGTVTGALGGVGGGGTG
GLGGVVGTVTGALGGIGGGNPTGGLGGVVGTVANTATGAVGTLTGALGGVGGGTGGLGGV
VGTVGNAASGAVGTVTGALGGVGDPTGGLGGVVGTVTGALGGIGGGTGGLGGVVGTVGNA
ASGAVGTVTGALGGVGGGGTGGLGGVVGTVTGALGGIGGGNPTGGLGGVVGTVANTATGA
VGTLTGALGGVGGGTGGLGGVVGTVANTATGAVGTVTGALGGGGGGTGGLGGVVGTVANT
ATGAVGTLTGALGGVGGGTGGLGGVVSTAANTATGAVGTLTGALGGVGGGTGGLGGIVGT
VANTATGAVGTLTGALGGVGGGTGGLGGIVGTVANTATGAVGTLTGALGGVGGGTGGLGG
VVSTVANTATGAVGTLTGTLGGVGGATGGLGSIVGTVANTATGAVGTLTGALGGVGGGTG
GLGGVVGTVANTATGAVGTLTGALGDIGGGTGGLGGVVSTVANTATGAVGTLTGALGGVG
GGTGSLGGVVGTVANTATGAVGTLTGTLGGVGGATGGLGNIVGTVANTGTGVVNAVTGVA
GNGGALITPITSIVGNLGGSLPVGAATGAIGAVSGAVTGVAGSGTAAITPLASAVTSLIG
SATSGAGGIAGAGTGVLTGATGAAGSLAAVTTGLTGTLANTVTGTTGAIAGTLPALSVAL
NGGTAAGAVGGATNAVGALVSGGATIANAAVHSVGSAVGSVAGVLPALAVSLNSDSAQGG
SAGAGGGLLAPVTSLVSSLTAPLPRK

BLAST