GenomeNet

>bde:BDP_0442 K02895 large subunit ribosomal protein L24 | (GenBank) rplX; rplX 50S ribosomal protein L24 (A)
MVAKIKSGDLVKVIRGKDRGKEGTVKQVLKDDRLIVEGVQIVKKHVRATQQGQQAGIVAV
EAPIHRSNVMVIDPETKQPTRVGVIVKEEARDGKVKTVRVRVAKKSGKELA

BLAST