GenomeNet

>bdi:100822395 K14826 FK506-binding nuclear protein [EC:5.2.1.8] | (RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53 (A)
MSFWGAEVKPEKPYTHTHSPRRGRLRVTQATIGGEASKAERGAKVRLQCTVKNRDPLLLC
TLLPGQSETLNLDLEFEEKYVTFSVLGPMSVHLTGYYIGNEYDEDIGDSDTGSDSDDGFL
VSDDDDGDMVIPASHDSEDGDSEYDSDYDSETGDEDLMYNQRRGKSSVVIEEIQEDDKPA
SGEGLKGSNKKQNSKNGDDSRLQLAVRAPPAESLESEDEDGFPVSESKKSSKGSSKKGTN
LNNVPNEDRKRKSGAISDHRDSSGEVDAENDGVSKKKKKAKDKKTAVDSEKLNSDEKEIK
QDSSANIVEAKQKKKKSKDASASEADADQQVKMIISDNNAEEVTKQGAKKKNKEKKTKEN
NTNEIQADTNLTKPDDKEQASQTRTFGNGMIVQTVALGKPDGKKASPGKKVSVKYIGKLK
NGTIFDSTVGKRPFEFRLGVGQVIKGWDIGVNGMRIGDKRKITIPPSMGYGNQKIGAIPP
NSTLVFDVELVNVK

BLAST