GenomeNet

>bdn:BBDE_0385 K03790 [ribosomal protein S5]-alanine N-acetyltransferase [EC:2.3.1.267] | (GenBank) putative acetyltransferase (A)
MTVFQAFRDMICPIRANAIAVPQFIQSQALQVPIRLRPLTADDDDEWNEVRWRNDAWLRP
WESGDPLHGQSMSFDMWIRRLRSNERDGTGVVFVMEHQRRIVGQISLGAICYGAMRTGVV
GYWVDERCAGRGFAPMAVTLLADWAMFDPDGPHLHRLEIALLPENARSRRVAVKVGAHFE
GVRRAYMYVNGRWRDHETYAMTSEDAPNGFTARLMTA

BLAST