GenomeNet

>bgg:CFK41_15650 K22893 serine/threonine kinase PknH [EC:2.7.11.1] | (GenBank) serine/threonine protein kinase (A)
MADVIVGRFALIDLIAKGGSGSVWRAWDSKTEKLCAAKVLRQRDSADLMRFVREKGVSFD
HPHLLTPYGWGAEDEHVVIAMPLVSGGTLESVVKKKGRLAEPAVVVILDQLLDGLSHIHA
EGWIHRDVKPANIMFEARGNAFPASRLADFGIAVHETDVRFTHVGMVNGTPGYMAPELFS
MAEPAPSHDLYAAGVVAMVALNGPIKLHDGSFRPEELNQHLQGVTPKLSAVIRRLVAAQP
EDRYQDADSVRRDLPRVPRGYPLTHADGTPLQFVDTLEPMPANAPGASRPQRPAATSSGP
SMEAIRSGRVQQGFSSPSASPQTGPQWAQQTPPQAAGAPQPQGAGSPPSAPFTPHPYTRT
QTTTGSTGQNQSSRRSTMIAIVLGSASALVLGALVAIILLAVFNNPSAAAPLDEGGGAVS
GVVASSGEVDGGSGLVPGASDGEGPATS

BLAST