GenomeNet

>blb:BBMN68_1588 no KO assigned | (GenBank) Membrane-associated protein (A)
MLVIVAIIIVVWLPVRTANGMKRVDEHRQDRYSPSLHIVDAENGRRFGDIKPHKAKGAAM
PASTPSARLTSEHIAHVRELRRAAIRRRQILAVCLLAITVLVFAVSFPLHFSPLLALIPF
VLLLLVLVLGANASRQARQWERKVVRYERAHSGTGWSKKPSAESKDSKRVNKAEPVAAVT
APAEKPAEQIEDAATEVMEQRQIRRALRDAEIEQAKAKALRQSAAAYQAAEEHAKQSEKS
DIAQSAADKPAAEPSAMVDESADRKSAAETSESSATPDASVRTDKSIESDKSVAPRVEPS
LTVRDERDERDDAAAAADATSELVSVRPARALDVFDMSTSQDLISFTLGGEHNADNAPES
LEIKSTRQVSKAEPVEPAVAEKLIDEARAVKAADDAKAVSAGNAVDTEPEQRDDADTDAD
DEAANAAQRAAFHESEERADVEAPAATTDSLGAGLDSILARRGN

BLAST