GenomeNet

>bma:BMAA1787 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (RefSeq) alkyl hydroperoxide reductase (A)
MLDAHLKTQLKSYLERITRPVELVASLDAGDQSRELRALLDEIAALSPQIFVTERRDAAE
RAPSFSVGEPGKAAGIRFAGMPMGHEFTSLVLALLQTGGHPIKLDDATIEQIRALDGDYA
FETYISLTCQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVEARRIMAVPTIFLNGET
FGQGRSSVKEILAKLDGGASRRAAQALAEKPVFDMLIVGGGPAGAAAAIYAARKGISTGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDVIDVERADRLVPGRVHE
IRLASGAVLKAKTVVLATGARWREIDLPPTNRASRSLVKFVFGEEDEHEEALYGTANHRV
SEGSRGRYAGQGTVQEAWVQ

BLAST