GenomeNet

>bmn:BMA10247_2557 K07444 putative N6-adenine-specific DNA methylase [EC:2.1.1.-] | (GenBank) THUMP domain protein (A)
MSSPTLFDFFAPCPRGLEAALAAELAQIAARHAIAPYDAGAQVPGGVHFRGAWAAGMAAN
LHSRIASRVLLKIAHRPYRNEQDVYALALEQPWERWFASTQTLRVDITAIKSPLKSLEFA
TLRVKDAICDRLREKTGARPSIDTAQPDVRVFAFLTAGDCTLYLDTSGEPLFKRGWRLDK
GAAPLRENLAAGILRLAGWTPGTPLYDPMCGSGTFVAEAAQIALGVAPGVERRFGFEKLK
QYDITAWQTLKVAAMDAKRAARGKRDDLLIFGSDISGDMLEKARANLERAGVPSLWLKQI
DARNMTPPAAAPGVIVTNPPYGERIEVRGRGPRGDVRETGKNRGGDEAFRRTHADSPDSE
FFRALGDALKQRFAGWQAFMLSSDRTLPGQLRLRESAKTPLFNGALECRLFRFDLIAGSI
RQRPAAADGE

BLAST