GenomeNet

>bmu:Bmul_1793 K07058 membrane protein | (GenBank) ribonuclease BN (A)
MPKLSVDLDTIKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFA
SFQISLQGFLADHLMPAQFNIQIFKYLNQFAAKAKGLTTAGLIVLVVTSVMTMMTIESAF
NLIWRVRKPRPFAQRVLAYWALITLGPLLFGVSLSLSSYLFTQSLAFTGAAPSTSIVEWL
LTLASLPLTVLAFTLLYVYLPNCTVAWRDAVIGGLFAAVAFELAKRGFGYYVRRIPTYTA
VYGAFAALPVFLLWMYLSWFIALLGAMVTSALPAIRIGQFHRVDYPGSDLLDALELLARL
AEARAAGKPGRSAIRLATMLRCDMQTAQRLLTLLEEREWVARLEGGEDSPRYILLANPER
LTLAQLFDVLVIDRAELTYQLQRRRSHIDGGALLAVLSSERFDVTLASLIAPHRLSGAQP
AAASEPAADDAPEPHAHPPRTA

BLAST