GenomeNet

>boz:DBV39_18060 K02031 peptide/nickel transport system ATP-binding protein | (GenBank) dppD; dipeptide ABC transporter ATP-binding protein DppD (A)
MTTDLAFIKIENLNITFNAGKKPVKAVDGVNLSVKRGEVIALIGESGSGKSVTLRSVLKL
HPPRRTQMQGRILVDGQDVMTLSGKALADFRGSKVSMIFQEPLLALDPVYTVGEQITEAI
RRHDNVTREEALQRALDLFERVRIPSPQRRLNAYPHEMSGGMRQRAMISLALASRPKLLL
ADEPTTALDATVQIQILLLLRELQRELGLSVIFVTHDIGAAVEVADRIAVMYAGRIVEEG
PVREIIRHPAHPYTQALLRSASHGGFAKGERLETIAGSPPDLANLPEGCSFAPRCPRATE
QCRQIDPQETWIDDTHRARCIRIESVSEATTAAV

BLAST