GenomeNet

>brn:D1F64_14550 K07090 uncharacterized protein | (GenBank) sulfite exporter TauE/SafE family protein (A)
MDTLIFLAAAVFVLAGTIKGTVGIGLPTAAVGILAQFIDPHLALALVVFPIMTGNAWQAY
RAGGMLATLKRYWIFALVSMVALWLSTFVTAAISTDTLITVLGGVIVIFAVTSLAFTPPV
IPDRFDRLAQIIAGVLAGIMGGFTAIWAPPMVIYFIARRVDKDEFVRASGLLIFLGSLPL
CLGFWQSGLLTGPNALISLMMIVPTLLGFTFGEILRRRLNDNRFRTAVLLIFLAMGLNLI
RKALF

BLAST