GenomeNet

>brq:CIT40_21495 K01761 methionine-gamma-lyase [EC:4.4.1.11] | (GenBank) cystathionine gamma-synthase family protein (A)
MVKPFPSKTHIGNHMLHPETLMLTYGYDPQLSEGAIKPPVFLTSTFVFKTADDGQDFFDF
VAGRREPPEGMGAGLVYSRFNHPNSEIVEDRLSIYERTEKCALFSSGMAAIATTILAFVR
PGDVILHSQPLYGGTETLLTNTLARLSIGAVGFADGIDEASVQQAAEEAMAKGRVSMILI
ETPANPTNGLVDVAMIRRIADSIGKAQGDTPIIACDNTLLGPVFQRPIEHGADISLYSLT
KYVGGHSDLIAGAALGSKALMKGIKALRGAIGTQLDPHSCWMISRSLETLSLRMEKADAN
ARLVADYLRDHPKVAKVHYLGHHEEASPAGRVFARQCLGAGSTFSFDIVGGKDAAVKFLN
ALQIIKLAVSLGGTESLASLPATMTHSGVPADIRRKIGVLDSTIRLSIGIENPSDLIADL
TQALNAA

BLAST