GenomeNet

>bsp:U712_01740 K10009 L-cystine transport system permease protein | (GenBank) putative amino-acid ABC transporter permease protein yckA (A)
MINSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIGLFISLARMSKLALLR
WPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFSLNSAAYIAEINRSAIS
SVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLDLIKASSLAAMITVPELL
QHAKIIGGREFDYMTMYILTALIYWAICSIAAVFQNILEKKYAHYV

BLAST