GenomeNet

>bsp:U712_11680 K17077 arginine/lysine/histidine transport system permease protein | (GenBank) Arginine transport system permease protein ArtQ (A)
MNLDFSATIPQIPFILEGLAITLKIVVVSAIIGLILGIVLSLCKISTFRPFIWIADFYTS
VFRGTPLVLQLMIVYFGLPQLLGFQIDQFWAAVVALSLNSAAYVSEIIRAGINAIDKGQK
EAAVALGVPYGKMMKDLLLPQAFKNISPAIVNELITLTKESAIVTVIGLGDVMRRAYQAG
AATYNYLEPLIIAGLIYYVLVLILTFIGKAVERKLKSND

BLAST