GenomeNet

>bsui:BSSP1_I0314 no KO assigned | (GenBank) bcsA; Glycosyl transferase, group 2 family protein, a member of the cellulose synthase superfamily (A)
MPQDRIENAFSAAHLHGTGFFEEAVHQPGVTERMVYEAIADYLQLPYTEEILPSRIFVSG
DENICFAHIRQVMVIGRDGISYLYIAPGERRIARLREHLKAAPQLRERIRICTPSVLKSI
LRQRHQRDLVMRAHAMTPQLFSAARVLDTPQAFVIAMAVYAFLGCIVNWPMKTMLALHVA
MSLFFFGCVLIRLFAAASGKRLQFTEIAPFKPRDLPVYSILVPLYREKDVVAQLIAALNR
LNWPRSKLDIKLVCEKDDYETIAAIRCNTMPSNFELVLVPPGGPRTKPKALNYALQFARG
EIVAVFDAEDRPHPDQLLEAWQAFRRGGSKLACVQAPLIIGNFRRNLLTRMFAFEYAVLF
RGLLPWLARRGLVIPLGGTSNHFRRSCLEQVGGWDAYNVTEDADLGMRLARFGYRIDVIS
RGTIEDAPEEHGVWHRQRTRWIKGWMQTWLVHGRQPMSTWRELGWWRFVVSQIYTLGIIG
SALLHPLMLLMLAGLCLRMAFGPLTPQGLWLLALDVINILMAYMSFHMLGAKTMEPTELG
GYAYFLAIPIYWVLISLSAWRAVWQLVRQPHLWEKTPHQPNLFYIPLEDASSEFDARNAA
PRPIMD

BLAST