GenomeNet

>bsul:BSUA_01023 K02440 glycerol uptake facilitator protein | (GenBank) glpF; glycerol permease (A)
MTAFWGEVIGTMLLIIFGAGVCAGVNLKKSLSFQSGWIVVVFGWGLGVAMAAYAVGGISG
AHLNPALTIALAFVGDFPWKEVPVYIAAQMIGAIIGAVIIYLHYLPHWKSTDDPAAKLGV
FSTGPSIPHTFANVLSEVIGTFVLVLGILAIGANQFTEGLNPLIVGFLIVAIGISLGGTT
GYAINPARDLGPRIAHAFLPIPGKGSSNWKYAWVPVVGPILGGSFGGVFYNAAFKGHITS
SFWIVSVILVVVLLGLYVYTKSHSAKTLSNSKYI

BLAST