GenomeNet

>btd:BTI_5102 K16319 anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1] | (GenBank) ring hydroxylating alpha subunit family protein (A)
MDPTESPVILIDHTDSSDVRFPHDDGSRVPYKVFSSQAVYDREQERIFRGQTWNFVALEA
EIPKPGDFKSTFVGDTPVVVTRREDGALAAWVNRCAHRGAQVCRKARGNASSHTCVYHQW
SFDSQGNLLGVPFRRGQKGMAGMPADFDPKNHGLRKLQVDSYKGLVFATFSDTVAPLPDY
LGAQMRPWIDRIFHKPIEYLGCTRQFSKSNWKLYFENVKDPYHASMLHLFHTTFNIFRVG
MKARSIPDATHGLHSIITMTKTRDDADTATAYKQQNIRSFDEGFSLEDDSILALVSEYDE
DTTNHIQPIFPQLVIQQIHNTLVARQLLPKGPKNFELIFHFFGYADDTPELRDLRIRQAN
LVGPAGYISMEDTEATELVQRGTVRDAHAASVIEMSRGNPDQQDTAITESLIRKFWVGYQ
QLMGY

BLAST