GenomeNet

>btei:WS51_17510 K07058 membrane protein | (GenBank) hypothetical protein (A)
MPKLSVDLDTLKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFA
SFQISLQGFLADHLMPAQFNVQIFKYLNQFASKAKGLTTAGLIVLVVTSVMTMMTIESAF
NLIWRVRKPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTQSLAFTGAAPSTSIVEWL
LAFASLPLTVLAFTLLYVYLPNCTVAWRDAVIGGLFAAIAFELAKRGFGYYVRRIPTYTA
VYGAFAALPVFLLWVYLSWFIALLGAMVASALPAIRVGQFHRIHYPGSDLLDALELLARL
AEARAAGKAGYTAMRLATMLRCDMETAQRLLLTMEEREWIARLESGEPAPRYILLANPEQ
LTLAQLFDVLVIDRTELTYQLQRRRSHVEGAALLEVLSNDRFDVSLASLIAAHRLAGEQP
EETVPGPAPGGARDPHARPPKTA

BLAST