GenomeNet

>bthl:BG87_1312 K07090 uncharacterized protein | (GenBank) sulfite exporter TauE/SafE family protein (A)
MSLPHIDLLYSLSGVFVGFLVGLTGVGGGSLMTPILVLLFNVHPATAVGTDLLYAAITKA
TGTFVHGLKGTVEWRITGRLAAGSVPAAAITLWLLHSHGMHSQATSRMIQLVLGAALLLT
SLSLLFRPQLAAFAAKRTRALPPSPARTLAATVLTGAVLGVLVSLTSVGAGAIGVTVLLL
LYPALSTTRIVGSDIAHAVPLTLVAGVGHWMLGSVDWAILVSLLIGSVPGIVVGSHLSTR
APEGLLRRILATTLVAVGAKLVLS

BLAST