GenomeNet

>cbh:CLC_1394 K02031 peptide/nickel transport system ATP-binding protein | (RefSeq) peptide/opine/nickel uptake ABC transporter ATP-binding protein (A)
MNILEVKGLRIEEEKNKKILVGNTNFEVEKGKITCIVGESGSGKTITAMSIIGMLPQGVR
VIEGEILFNGKNTFNFSKEKLRDFRGKKIFSIFQNSINCFNPSVIMETQIYNMICSHYSI
DKENFRNKLINIMKNINLKNPEIILKQYPFQLSGGMLQRMMIASAILMEPDIIIADEPTT
ALDLTSQKDILNQLKMIKEKLNTTILMITHDFGVVAEIADNVIIMQNGNIIEKGNVYNIF
DNPQENYTKTLINATFKREVTYVC

BLAST