GenomeNet

>ccae:111945440 K10846 DNA excision repair protein ERCC-5 | (RefSeq) DNA repair protein complementing XP-G cells-like (A)
MGVQGLWKLLECTGRPINPETLEGKILAVDISIWLNQAIKGARDRGGISVRNAHLLTLFH
RLCKLLFFRIRPVFVFDGEAPLLKRQTLAKRRQRKEIAINDSRKTTEKLLKTLLKRHVIK
TALTGKSNEALPSITQARRERVDDMYVLPALEDEEKNSSEEEEEKEWQMRMNQRKMLQEQ
LCENPYSVDIESEDFHKLPPEIKHEILTDIKELTKRRRTLFEAMPEDSNDFSQYQLRGLL
KKSNLNRCIENVQKEMNQQHSGEIQTQYENEGGFVKEVESRRVVSEETSHYILIKGIQAK
EAMSRDLEATAGPSSKMHDLTKLNKISESPANAKLPASDKKQTEEADNVVAAPPSPRTLL
AIRAAMVESSSEEELDAGQLNVDQFVSEEGSVSPRTLRAIQQALSEDDNGEEVVTATTDG
VLSERPEKKDFLLNSSDEEEQIPDVKEGTNIPTAAIHSSIQVTMQDAEFKQKGQELEKNH
ITLKDTGVFRNENYSAIENIRKGKEDIDKEENYSENHIAPKDISIARAETYIDCTIKDKE
DVDKEENGSKNHISPNDTSISRAENYSYNNNTRNDKEDLDKEKNGSKMDIKSLGDKDMNL
CLQKPRCSPVQTGIDALSRAETTDLSKNEENVKISENTQEVISQTEENISGVTRVFPGAR
DPKEEREGISQSEDSDSDGSFIEVDAEVSNEAEFPTKYDEKMGDEPTLPEVETDRPDVFT
LDLLKESDEVQLGNTQNAEKEADDKSAVDEWQDISLEELEELEKDLSAEQNMLQSQKQQQ
ERVAASVTGQMFLESQELLRLFGIPYIEAPMEAEAQCAILDLTDQTSGTITDDSDVWLFG
ARHVYKNFFSHNKYVEYYQYVDFQNELGLDRSKLINLAYLLGSDYTEGIPNVGFVTAMEI
LNEFPGHGLEPLVKFAEWWNEAQKNKKARPNPHDTKVKKKLRELQLYSGFPNPAVAEAYL
KPVVDESRGSFTWGKPNVEQIREFCKDHFGWTRTKIDGILLPVMKQLNSQQTQLRIDSFF
RLEQHEKQAIKSQRLRRAVTCLKRKEKEADDEIQEATAVMELELKQPGKKTGEGTTGGAN
QAAATKVQSGKRRKHSDSRKEFLYGGGFVGNLHLSETSSDSSVEESKGRGLGKSKRRKNM
SATETADHKEKKGCSSSSGEDEDLGNVVMVTAKPVFEGRKKKSRSKRGMRKKMS

BLAST