GenomeNet

>ccan:109686946 K00710 polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41] | (RefSeq) Wbscr17; putative polypeptide N-acetylgalactosaminyltransferase-like protein 3 isoform X1 (A)
MLEDLREGGVGCSPGSWCSPWPLASSNSAFPVCLRCKELKYGKELPQISIIFIFVNEALS
VILRSVHSAVNHTPTHLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGL
IRARIEGWKAATGQVTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQ
RYENSAHGYSWELWCMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGDIGLLDPG
MDVYGGENIELGIKVWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWM
DDYKSHVYIAWNLPLENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAY
GELRNNKAKDVCLDQGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRC
LVDNSKSRLPQLLDCDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSC
TGQRWTIKNSIK

BLAST