GenomeNet

>ccar:109108561 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] | (RefSeq) LOW QUALITY PROTEIN: DNA ligase 1-like (A)
MQRSIASFFQPMKSKEKSDGQVKTKSEPVKSPLKIQNGVQESDSPVKKVHKRSRAIIDSD
DEDQQIVKEQVPKHSEVEPVKPEQKSGVTKAASTPVSPKTPITPRTPVTSSTSVAVVTPA
SSGTPGTPATPTSTSPSGIPKRKTARKQFPKRKLDSRSDGEGAKEEEKEVDEGQESKRAR
VEASPGQTDNEMMEVEEKSTDGKTAAEEQKEKDEAKTTVAEDNANNKMKEKEKNKVKQEK
KINGENGKKEKKDKKEKEHCSPERAVKKEKSEEEEGGSAKKKPISSLFCFYNEMMEEKKI
NGENGKKKKKNKKEKEHCSPERAVKKEKSEEEEGGSAKKKPISSFFAPRKAAVKLEKEER
NEGEKRKDGEISDATEPKEKKSEKGVDSAVQSQYDPSRAHYHPVDHACWKKGQKVPYLAV
ARTFERIEEDSGRLKNIETLSXLLRSVILLSPDDLLCCVYLCLNQLGPAYQGLELGIGET
ILMKAVAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQRMMFAPANLTAGGVFNKLKEIA
NMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLTALSQAVCLSPP
GQEFPPAVLDAGKGMSAENRRVWLEEKALILKQTYCEMPNYDAIIPVLMKEGIDELPNHC
KLTPGVPLRPMLAHPTKGVGEVMKRFDEASFTCEYKYDGERAQIHILENGEVRIFSRNQE
DNTSKYPDIISRIPQVKKENVRSCVLDSEAVAWDREKKQIQSFQVLTTRKRKDVDASEIK
VQVCVYAFDLLYLNGESLVREPLSKRRALLRESFEEKEGEFVFARSLDSDNTESIAEFLE
QSVRDSCEGLMVKTLEKHATYEIAKRSHNWLKVLHTTVCLCSYQTAGTKGTLKYILYECH
VLVMYLFVYFCQIGTGFKDEDLEQHYSFLKEHILPKPRPYYRVDQSAEPDVWLEAVQVWE
VKCADLSLSPVYKAAMGLVDPEKGISLRFPRYLRIRDDKKPEDATTGSQIADLYKKQQQI
QNQGEKQDLEDYY

BLAST