GenomeNet

>cdk:105106153 no KO assigned | (RefSeq) CPT1B; carnitine O-palmitoyltransferase 1, muscle isoform (A)
MAEAHQAVAFQFTVTPEGVDFRLSREALKQIYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVVITTVGSSYCNVDISRGLVCYIQRCLPERCGPYRTPQTRALLSMAVFSTGVWMMG
IFFFRQTLKLLLSYHGWMFEMHGKTSCFTKVWAICVRLLSSRRPMLYSFQASLPKLPVPS
VPATVHRYLESVQHLLDDEEYCRMEVLAKEFQEKTAPRLQKYLVLKSWWATNYVSDWWEE
YVYLRGRTPLMVNSNYYVMDLVLVKNTDVQAARLGNAVHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRIPGKDADVLQHLTDSRHVAVYHKGRFFKVWLYEGSHLLKPRDL
EMQFQRILDDPSPPQPGEERLAALTAGGRVEWAQARQAFFSSGKNKAALDAIERAAFFVA
LDEESHGYDPEDEASLSLYGKALLHGNCCNRWFDKSFTLIAFKNGQLGLNTEHAWADAPI
IGHLWEFVVGTDAFHLGYAETGHCLGKPNPLLAPPQRLQWDIPEQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTRESTAFVQAMVEGRHMKADLQDLFRKAAEKHQNMYRLAMTGAGIDRHLFCL
YVVSKYLGVSSPFLAEVLSEPWRLSTSQIAQFQIRMFDPNKYPNHLAAGGGFGPVADDGY
GVSYMIAGENTIFFHVSSKFSSSETNAQRFGNHIRQALLDIADLFQVPKADR

BLAST