GenomeNet

>cfa:483314 K21952 CASK-interacting protein | (RefSeq) CASKIN2; caskin-2 (A)
MGREQDLILAVKNGDVTGVQKLVAKVKAAKTKLLGSTKRLNVNYQDADGFSALHHAALGG
SLELIALLLEAQATVDIKDSNGMRPLHYAAWQGRLEPVRLLLRASAAVNAASLDGQIPLH
LAAQYGHYEVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRLKVAQLLLNSHLCVALLEGE
AKDPCDPNYTTPLHLAAKNGHREVIRQLLRAGIEINRQTKTGTALHEAALYGKTEVVRLL
LEGGVDVNIRNTYNQTALDIVNQFTTSQASREIKQLLREASGILKVRALKDFWNLHDPTA
LNVRAGDVITVLEQHPDGRWKGHIHESQRGTDRVGYFPPGIVEVVSKRVGVLAPRLPSAP
TPLRPGFSRTPQPPADDPLHPLTYGQLPRVGLSPDSPAGDRNSVGSEGSVGSIRSAGSGQ
SSEGTNGHGTGLLIENAQPLPSMGEDQVLPGLHALPLADNLNHRPLVHYRSGEQLFTQDV
RPEQLLEGKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRK
KIASEIAQLSIAEWLPNYIPADLREWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQE
IGVNKLGHQKKLMLGVKRLAELRRGLLQGEVPVEGGGRRLARGPELMAIEGLENGDGPAA
TGPRLLTFQGSELSPELQAAMAGGGPEPLPLPPARSPSQESIGARSRGSGHSQEQPAPQP
SGGDSSTPQERNLPEGTERPSKLCSPPPGQGPPPYVFMHPQASPSSPAPGPPPGAPRAFS
YLAGPPATPPDPPRPKRRSHSLSRPGPAEGEAEGEAEGPADSALGSYATLTRRPGRSALA
RTSPSPTPARGAPRSQSFALRARRKGPPPPPPKRLSSVSGPTTEAPSLDGSPGPKEGASG
PRRRTLSEPTGPSEPPSPPVPAGPVSDTEEEEPGPEGTPPSRGSSGEGLPFAEEGNLTIK
QRPKPAGPPPREAPVPAGLDFNLTESDTVKRRPKCREREPLQTALLAFGVASATPSPSAP
LPSQTPSEPSSAAPSPPRLDPSSLPTQGAPAPLSPSPQTQPSAPPCPGPALESSTGDWRH
GETEPPASPAALIKVPGAGTAPKPVSVACTQLAFSGPKLAPRLGPRPVPPPRPESTGAVG
SGRAQQRLEQTSSSLAAALRAAEKSIGAEEREGPPSTSAKHILDDISTMFDALADQLDAM
LD

BLAST