GenomeNet

>cii:CIMIT_05830 K00624 carnitine O-acetyltransferase [EC:2.3.1.7] | (GenBank) hypothetical protein (A)
MPLPPLEQTLSEYATALSAMLDEEERAHASRVIEDFAHSKGPLLDAALRKRAVSREAEGT
NWLHDEWYEGYLAVRGPLQLSTNVGFQLAPFGAGTTGTQRAAAAIQRIATVHLQAAGDAL
PEDVDARGNRITLNQWFVFNGGLRHPRPDVDEVAVCTKSAADREIGIFVDGRLFALPISD
AEGNVTPHEHLAANLDTVLAAARTPSPDQADFNAAALAGDESELTELIERNPHTYQRLAD
LLFTVDLVNTSGRDDAALLADLAFRPRGAWVYKPLSYQLGLDSDWTAVHVEHTCQDGGTL
VTAVSRMQDANVQESPTLAEQAPEELRWELDHAPDTPAAPYTVELRPVDIPPTDLPFKFS
RDASAQLIMTIAQQLTYGRVRAVYEAVDMREYRAGRTECLRALTPEAAAFARALVAGTAT
REQLVAAAEAHRGWVKRCKSGNGIDRHIQMLELLDAQETGTATDPFCSDPVVTAARKDFL
STTSVGSANQIVRYAFAPTLPEGFGIAYTPLTETTKYCVSYNTETAEKPQEFLANLARAS
ELLWQFCGELDG

BLAST