GenomeNet

>cja:CJA_0376 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) ahpF; AhpF (A)
MLDAAIKGQLKAYLEKLQRPIELVASLDDTAKSRELKSLLDEITALSDNVSARLDGNSVY
RPSFGVARPGETPRIEFAGIPLGHEFTSLVLALLHTGGHPARIDAATLEQIKAIDGQFHF
DIFVSLSCHNCPDVVQAVNTMAAQNPNISATMIDGALFQGEVEKRQIMAVPSVYLNGQHF
GQGRMTLEEILAKIDTGAAEREAKLLNGKVPFDVLVVGGGPAGSAAAIYAARKGIRTGVV
AERFGGQVLDTLAIENFISVTETEGPKLAMALEQHVKEYDVDVMNLQKAAELIPGDLIEV
KLASGASLKSKSVILTTGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGN
SGVEAAIDLAGIVAHVTLLEFDSTLRADAVLQRKLLSLPNVTVITEALTSEVLGDGQKVT
GLTYKNRNTDDLTQVELEGIFVQIGLLPNTDWLKGTVALSQRGEIEINTRGETSVPGVFA
AGDCTTVPYKQIIIAMGAGSTAALGAFDHLIRASAP

BLAST