GenomeNet

>cmk:103174269 K01872 alanyl-tRNA synthetase [EC:6.1.1.7] | (RefSeq) alanyl-tRNA editing protein Aarsd1-B-like (A)
MASGRNGRETGTICPDITDSQEQARGLDGLGPLLVIPLTARSAPLPVPQVIKLLGTDKGK
KNKTNLIFLVGNRVLSYMDKCLATERALTSLLKNGPNEHVQGVDKLQKSVKLLHKVRRCR
WDLGVD

BLAST