GenomeNet

>cos:Cp4202_1695 K16012 ATP-binding cassette, subfamily C, bacterial CydC | (GenBank) cydC; ATP-binding/permease protein cydC (A)
MRNRDLVGAILAASITLISALGLSVLSGWLITRAWQMPPILDLAIAITAVRALGISRAVF
RYIDRLISHRLALRALRNLRSTVFQSIAETTTPHSDAILTQGDQLTRLSKDTERVTDFIV
RSLVPSGTALVVSIIAVTFTFLLLPSAGLVLLVSFCVTGLFIPWLSQRSSNKLLQRTAVE
SEDAWEQKLQEVLSHRVEFHAAGIAQQRADSAIDASRRASDDQIRATRNDSVQAFLLSLS
CDLTVLAIAWLGLQNYSGSPMWLGMLVILSLAAFESHAELAKASIHADVVSTASQALAEV
TGKALPSPPEASLFTDTTLKVSHLQCLHTDKTWDFTLAPNERRLITGPSGVGKTTLLYTL
AGLLEPRSGSASIGGDSSAAARRSLIRMHPENEWLFSTNIRENIRVANPDAPDALIEATL
RALGMGQWLDTNQGLDTVLVDGASSLSSGQRRRLLLARALCSTAPILLLDEPTAHISHTD
ASRFLDILLHKPLPGALPQRSLIIVSHSQ

BLAST