GenomeNet

>cpic:101953088 K03254 translation initiation factor 3 subunit A | (RefSeq) EIF3A; eukaryotic translation initiation factor 3 subunit A (A)
MPVYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLGQIQRHHNQSTAINLSNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYHKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRISLINDMVRFNVVQHVVPEVKELYNWLEVDFHPLKLCDRVTKVLNWVRDQVEK
EPELQLYVPHLQNNTILRLLQQVAQIYQTIDFSRLTTLVPFVDAFQLERAIVDAARHCDL
QVRLDHTSRTLSFGSDLNYSTREDAPLGPQLQSMPSEQIRNQLTAMSSALAKALEVIKPP
NIVQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQXEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKTAYEEQRIR
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDKDLFVSRLKAARQSIYQEKLKQFE
ERLAEERHNRLEERKRQRKEERRVSYYREKEEEEQRLQEEKMLKELEEKERVEREKREQE
QREYQERVRKLEEVERKKRQREQEIEERERRREEERRGLDDPLSRRESRWGDRDADNTWR
RTAEPESEWRRAPPEREWRRGEGRDDERPFRRGDDLLRRGGAEEKEPSSREANEDRAPKQ
DVEEDGEPRRGMDEDGEPRRDEDREPRRDEDGEPKRDEDVEPRRGMDEDGGPRRGVDQDR
GSWRTADDDRGPRRGLDDDRGPRRGLDDDRGPRRGLDDDRGPRRGLDDDRGNWRTADEDR
GPRRGLDEDRGPRRGLDEDRGSWRTADDDRGPRRGLDDDRGPRRGLDDDRISRRDEDRGP
WRSADEDRLSRRDEDRGPWRGGDDDRGPRRGDDSRPGPWRPFGKPGGWREREKAREDSWG
PPRDSRPSEDRELDRDKDIDENEKDREFDKDRDLDRDDRFRRPRDEAGWRRGPAEEVSSW
RDSGRRDEWDRGGRDMRDDRGGRDLRDRRADDRDRRGPPIRTDREETSSWRRGDDRKEER
GEERETIRRAAPAPALAPAPAPTPVPAAAPAAPPISKDRERDAESEKGSWRTEKERESLR
RTKNETDEDGWTTVRR

BLAST