GenomeNet

>csat:104740855 K10801 methyl-CpG-binding domain protein 4 [EC:3.2.2.-] | (RefSeq) methyl-CpG-binding domain protein 4-like protein isoform X1 (A)
MFPPVIYTYTRRRCRRLGRDDDSSVMMTRRRPDSATIEVRDENHSIGLFKEDDDDDIIRD
LGCIDESETRHGSSNLLSQCHRDDVCFLDKDNKSDSFVSCRRNLDDLFLGFAYKGVRSRK
RDDFGSETTSNLVSPRIADDDSVSESHLQVRRVSPYFQGSTVSQQSKVGCDSRSVCSQSR
RSCRKGCRKIQAKVPRVSPYFQASAISQCGSDIVSSQSVSRRESSKLQAKVRRVSRYFQA
SADSEQPRGLRRYFKVVKVSRYFHDVVPADGIEIDDSQKEKSRRVRKTPVVSPLLSLSQK
TDEAYLRKTPDKTWVPPRSPCNLLQEDHWHDPWRVLVICMLLNKTSGAQTRGVISDLFAL
CPDAKTAIEVEEKEIESLIKPLGLQKKRAKMIQRLSLEYLQENWTHVTQLHGVGKYAADA
YAIFCNGNWDRVKPNDHMLNYYWEFLRIRYKL

BLAST